PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g039040.1
Common NameMTR_1g039040, NF-YB10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NF-YB
Protein Properties Length: 191aa    MW: 21648 Da    PI: 5.8644
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g039040.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1702.8e-53599296
            NF-YB  2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
                     reqd+++Pianv+rim+++lP++akis+daket+qecvse+isf+tsea+d+cqre+rkt++++d+lwa+++lGf+dyv+pl+ yl++yre ege
  Medtr1g039040.1  5 REQDQYMPIANVIRIMRRILPSHAKISDDAKETIQECVSEYISFITSEANDRCQREQRKTVTAEDILWAMGKLGFDDYVHPLTFYLQRYRESEGE 99
                     89******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.8E-483105IPR009072Histone-fold
SuperFamilySSF471135.28E-377106IPR009072Histone-fold
PfamPF008085.0E-261074IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.1E-163856No hitNo description
PROSITE patternPS0068504157IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006158.1E-165775No hitNo description
PRINTSPR006158.1E-167694No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MAGIREQDQY MPIANVIRIM RRILPSHAKI SDDAKETIQE CVSEYISFIT SEANDRCQRE  60
QRKTVTAEDI LWAMGKLGFD DYVHPLTFYL QRYRESEGEP ASVRRTSSLA LPPSFPLMQQ  120
HSSSFSSMPL PLINNNNHNS NGYGHGYGFD FDQGFYRDGG DDAAPSSASF VPNFDCNFLH  180
LKRDNHNNNM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A3e-40595393NF-YB
4awl_B3e-40595494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-40595494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1517090.0AC151709.9 Medicago truncatula clone mth2-31g22, complete sequence.
GenBankJQ9182830.0JQ918283.1 Medicago truncatula nuclear trancription factor Y subunit B10 (NF-YB10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003589766.11e-143ccaat-box-binding factor HAP3-like protein
SwissprotQ84W662e-58NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLG7ICG41e-143G7ICG4_MEDTR; Ccaat-box-binding factor HAP3-like protein
STRINGGLYMA20G00240.11e-73(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.22e-59nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]